General Information

  • ID:  hor006226
  • Uniprot ID:  P55208
  • Protein name:  CNP-22
  • Gene name:  NA
  • Organism:  Triakis scyllium (Banded houndshark) (Hemigaleus pingi)
  • Family:  Natriuretic peptide family
  • Source:  Animal
  • Expression:  CNP-115 is differentially processed to produce CNP-38 and CNP-39 in the heart and CNP-22 in the brain.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Triakis (genus), Triakidae (family), Carcharhiniformes (order), Galeoidea (superorder), Galeomorphii , Selachii (infraclass), Elasmobranchii (subclass), Chondrichthyes (class), Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0006182 cGMP biosynthetic process; GO:0007168 receptor guanylyl cyclase signaling pathway; GO:0097746 blood vessel diameter maintenance
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  GPSRGCFGVKLDRIGAMSGLGC
  • Length:  22(115-136)
  • Propeptide:  MSGQTSFYCGLLLVLLIQAQARPRSDDSLQTLSRLLEDEYGHYLPSDELNNEAQEMSPAASLPEFNADQSDLELPWDRESREIGGRPFRQEAVLARLLKDLSNNPLRFRGRSKKGPSRGCFGVKLDRIGAMSGLGC
  • Signal peptide:  MSGQTSFYCGLLLVLLIQAQA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Hormone which may be vasoactive and natriuretic. Has a cGMP-stimulating activity (By similarity).
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  45830
  • Structure ID:  AF-P55208-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006226_AF2.pdbhor006226_ESM.pdb

Physical Information

Mass: 255634 Formula: C91H153N29O27S3
Absent amino acids: EHNQTWY Common amino acids: G
pI: 8.83 Basic residues: 3
Polar residues: 10 Hydrophobic residues: 6
Hydrophobicity: 26.36 Boman Index: -1677
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 70.91
Instability Index: 3071.36 Extinction Coefficient cystines: 125
Absorbance 280nm: 5.95

Literature

  • PubMed ID:  1474339
  • Title:  Different molecular forms of C-type natriuretic peptide isolated from the brain and heart of an elasmobranch, Triakis scyllia.